PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400045450
Common NameLOC102589608, STK
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family GeBP
Protein Properties Length: 220aa    MW: 24664.2 Da    PI: 9.8054
Description GeBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400045450genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF57368.61.3e-212672997
                DUF573 29 spsddidafyefvkksisfkvsksqlveKirrLKkKfkkkvkkaksgkepsfskehdqkifelskkiWg 97
                          +ps+d++af+ef++++++++vsksq+++K+rrLKkKf ++vk+   g+ep+f+k +d  ife+sk+iWg
  PGSC0003DMP400045450  2 EPSADMSAFHEFIRGKLQAEVSKSQISDKVRRLKKKFLTNVKD---GEEPVFTKGQDFLIFEHSKRIWG 67
                          6899*************************************99...**********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF045047.5E-17267IPR007592Protein of unknown function DUF573
Sequence ? help Back to Top
Protein Sequence    Length: 220 aa     Download sequence    Send to blast
MEPSADMSAF HEFIRGKLQA EVSKSQISDK VRRLKKKFLT NVKDGEEPVF TKGQDFLIFE  60
HSKRIWGAPG ISNGGVKDNV NNTSNGKAKK TVEVKKSSEP KKSAKVSKPK DDEKQKEEEQ  120
QVAVKEVVKE DIVKGDQQDF QSKYPRLAAS LETMSGLSTM YPNGSSLLKE NMSLIATDKA  180
KVLEEKWKKL EDDEAALMVK RLDFIAEHYR LVVDAMRGN*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAJ3146120.0AJ314612.1 Solanum tuberosum mRNA for storekeeper protein (STK gene).
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001305529.11e-157neurofilament heavy polypeptide-like
TrEMBLM1CH591e-159M1CH59_SOLTU; Uncharacterized protein
TrEMBLQ94IK21e-157Q94IK2_SOLTU; Storekeeper protein
STRINGPGSC0003DMT4000673631e-159(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA23692041
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G00390.13e-15DNA-binding storekeeper protein-related transcriptional regulator
Publications ? help Back to Top
  1. Zourelidou M,de Torres-Zabala M,Smith C,Bevan MW
    Storekeeper defines a new class of plant-specific DNA-binding proteins and is a putative regulator of patatin expression.
    Plant J., 2002. 30(4): p. 489-97
    [PMID:12028578]